The short version of GSSG fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-08-18 and is reviewed periodically as new material appears.
Glutathione participates in detoxification reactions, amino acid transport, and the maintenance of protein thiols. It serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. In research literature, altered glutathione status appears in studies of aging, infection, metabolic stress, and environmental exposure. Whether low glutathione is a cause, consequence, or marker of such conditions often remains unresolved. Direct measurement in blood or tissue provides a snapshot, but results depend on sample handling, timing, and the method used.
Glutathione is a small tripeptide made of glutamic acid, cysteine, and glycine. Its cysteine thiol group allows reversible oxidation and reduction, making it central to cellular redox chemistry. The reduced form, often abbreviated GSH, predominates inside most cells, while the oxidized disulfide form, GSSG, forms when two GSH molecules react. The ratio of GSH to GSSG is widely used as an indicator of oxidative stress in laboratory research, though it does not by itself diagnose a clinical condition.
Biosynthesis occurs in two ATP-dependent steps. The enzyme glutamate-cysteine ligase joins glutamate and cysteine, forming gamma-glutamylcysteine; glutathione synthetase then adds glycine to produce the complete tripeptide. Because the peptide bond from glutamate uses the gamma-carboxyl group, glutathione resists digestion by many ordinary peptidases. Tissues vary in synthesis capacity, and the liver generally contains high concentrations relative to many other organs. This uneven distribution contributes to organ-specific differences in redox buffering and affects how experimental results are interpreted across tissue types.
In living systems, glutathione occurs in millimolar concentrations in many cell types, while extracellular levels are generally much lower. The liver holds a substantial share of the body's total pool, and the molecule participates in reduction, detoxification, and amino acid transport. It also serves as a cofactor for enzymes such as glutathione peroxidase and glutathione S-transferase. Because the cysteine residue supplies a reactive thiol, glutathione can donate electrons and become oxidized. Cells regenerate reduced glutathione through glutathione reductase using NADPH.
Commercial glutathione is produced by microbial fermentation or chemical synthesis, then purified. Reduced and oxidized grades are offered separately, with purity specifications often exceeding 98 percent. The compound appears in foods such as fresh fruits, vegetables, and meats, although cooking and processing can lower amounts. Oral, topical, and inhaled forms are discussed in research and consumer contexts, but absorption and tissue delivery remain active areas of study. Regulatory status varies by country and intended use.
Glutathione is a small sulfur-containing peptide built from glutamic acid, cysteine, and glycine. Its distinctive feature is a gamma-glutamyl bond between glutamate's side-chain carboxyl group and cysteine's amino group. This linkage resists ordinary peptidases and helps the molecule remain stable inside cells. The reduced thiol form, often abbreviated GSH, is the dominant intracellular species. The oxidized disulfide dimer, GSSG, forms when two reduced molecules link through their cysteine sulfur atoms. The balance between these forms is a common redox indicator.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C10H17N3O6S | Reduced glutathione (GSH); oxidized form differs by disulfide linkage. |
| Molar mass | 307.32 g/mol | Calculated for the reduced tripeptide. |
| Appearance | White to off-white crystalline powder | Typical laboratory reagent description. |
| Solubility | Soluble in water | Aqueous solutions are acidic; solubility depends on pH and salt form. |
| CAS Registry Number | 70-18-8 | Refers to reduced L-glutathione; oxidized form has a different number. |
Interpreting glutathione measurements requires attention to pre-analytical variables. The GSSG concentration in a sample can rise artificially during storage or processing, making the GSH/GSSG ratio unreliable if not controlled. Reference ranges vary by specimen type, assay, and population, so comparisons across studies are difficult. Plasma glutathione is low and sensitive to hemolysis, while whole blood reflects primarily erythrocyte content. Many studies measure total glutathione rather than the reduced and oxidized forms separately, which limits conclusions about redox status.
Accurate measurement of glutathione begins with careful sample handling. Because GSH oxidizes rapidly to GSSG, samples must be processed quickly or frozen immediately. Acid precipitation with metaphosphoric acid or perchloric acid is common; it lowers pH, precipitates proteins, and helps preserve the reduced form. Chelating agents such as EDTA can limit metal-catalyzed oxidation. For whole blood, hemolysis releases glutathione from erythrocytes, so plasma and serum values differ substantially from whole blood values.
Glutathione serves as a cofactor for several enzymes, including glutathione peroxidase and glutathione S-transferase. These enzymes help reduce hydrogen peroxide and lipid peroxides, and they conjugate reactive electrophiles for excretion. The molecule also acts as a reservoir for cysteine, an amino acid that is prone to oxidation. In addition, glutathione participates in the metabolism of nitric oxide, leukotrienes, and prostaglandins. Its roles extend to cell signaling, apoptosis, and the regulation of protein function through S-glutathionylation.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine, and it is the most abundant non-protein thiol in most living cells. The reduced form, GSH, carries a sulfhydryl group that can donate electrons, while the oxidized form, GSSG, forms when two GSH molecules link via a disulfide bond. The balance between these two forms helps define the cellular redox environment, and their ratio is often used as an indicator of oxidative stress. Because the sulfhydryl group is reactive, glutathione participates in many cellular processes, including detoxification and protein regulation.
Cells synthesize glutathione through two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine, and glutathione synthetase adds glycine to form the complete tripeptide. Breakdown occurs through gamma-glutamyl transpeptidase and subsequent peptidase reactions, forming the gamma-glutamyl cycle. Within cells, glutathione also forms a disulfide-linked dimer called GSSG when two GSH molecules react. The balance between GSH and GSSG is widely used as an indicator of oxidative conditions, although the ratio can vary by compartment and tissue.
Glutathione supports several cellular processes beyond direct antioxidant action. It serves as a cofactor for glutathione peroxidase and glutathione S-transferase enzymes, which reduce peroxides and conjugate electrophiles, respectively. The molecule also acts as a reservoir of cysteine, an amino acid that can limit protein synthesis and redox signaling. In human nutrition, oral glutathione is sold as a supplement, but how much intact glutathione reaches tissues after ingestion remains an active research question. Clinical claims about supplementation are not uniformly supported by controlled trials.
Glutathione is a small tripeptide built from glutamic acid, cysteine, and glycine. Its peptide bond between glutamate and cysteine involves the gamma-carboxyl group rather than the usual alpha-carboxyl group. This structure gives the molecule a reactive thiol on the cysteine residue. The reduced form, often abbreviated GSH, is the predominant intracellular species in many cell types. Because the thiol can donate electrons, glutathione participates in redox chemistry and in the conjugation of reactive molecules.
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
=== Dosage units === One international unit of insulin (1 IU) is defined as the "biological equivalent" of 34.7 μg pure crystalline insulin. The first definition of a unit of insulin was the amount required to induce hypoglycemia in a rabbit. This was set by James Collip at the University of Toronto in 1922. Of course, this was dependent on the size and diet of the rabbits. The unit of insulin was set by the insulin committee at the University of Toronto. The unit evolved eventually to the old USP insulin unit, where one unit (U) of insulin was set equal to the amount of insulin required to reduce the concentration of blood glucose in a fasting rabbit to 45 m g/d L (2.5 m mol/L). Once the chemical structure and mass of insulin was known, the unit of insulin was defined by the mass of pure crystalline insulin required to obtain the USP unit. The unit of measurement used in insulin therapy is not part of the International System of Units (abbreviated SI) which is the modern form of the metric system. Instead the pharmacological international unit (IU) is defined by the WHO Expert Committee on Biological Standardization.
{\displaystyle P(t)=e^{Qt}={\begin{pmatrix}p_{\mathrm {AA} }(t)&p_{\mathrm {AC} }(t)&p_{\mathrm {AG} }(t)&p_{\mathrm {AT} }(t)\\p_{\mathrm {CA} }(t)&p_{\mathrm {CC} }(t)&p_{\mathrm {CG} }(t)&p_{\mathrm {CT} }(t)\\p_{\mathrm {GA} }(t)&p_{\mathrm {GC} }(t)&p_{\mathrm {GG} }(t)&p_{\mathrm {GT} }(t)\\p_{\mathrm {TA} }(t)&p_{\mathrm {TC} }(t)&p_{\mathrm {TG} }(t)&p_{\mathrm {TT} }(t)\end{pmatrix}}}
US and South African justification for arming UNITA lay partly in the increased supply by the Soviet Union of more sophisticated weapons to FAPLA, as well as the increased number of Cuban troops in Angola, which had rapidly swelled from 25,000 to 31,000 by the end of 1985. While the Lusaka Accords were still in force, the Cuban and Soviet military delegations had urged dos Santos to take advantage of the ceasefire with the SADF to eliminate UNITA. There was a considerable increase in Soviet military assistance to Angola during this period, with the transfer of another billion dollars' worth of arms to FAPLA, including about 200 new T-55 and T-62 tanks. Moscow trained more Angolan pilots and delivered more advanced fighter aircraft to Luanda, particularly Mikoyan-Gurevich MiG-23s. Over a three year period Angola had become the second largest importer of arms on the African continent. FAPLA's arsenal expanded so exponentially that the SADF became convinced that the Soviet-sponsored arms buildup was intended for deployment elsewhere. General Malan gave a speech in which he expressed alarm at the "flood" of Soviet military equipment and its sophisticated nature, claiming that it was much more than needed to cope with the SADF's limited expeditionary forces and UNITA. Malan theorised that "the Russians want to develop a strong, stabilised base in Angola and then use the equipment and personnel positioned there wherever necessary in the subcontinent".
non-coding DNA (ncDNA) Any segment of DNA that does not encode a sequence that may ultimately be transcribed and translated into a protein. In most organisms, only a small fraction of the genome consists of protein-coding DNA, though the proportion varies greatly between species. Some non-coding DNA may still be transcribed into functional non-coding RNA (as with transfer RNAs) or may serve important developmental or regulatory purposes; other regions (as with so-called "junk DNA") appear to have no known biological function.
Sources: en.wikipedia.org
=== 6 May === In Russia, the governor of Belgorod Oblast claimed that eight people were killed and 35 others were injured in a Ukrainian drone strike that hit three vehicles in the village of Berezovka. Russia claimed to have taken the villages of Soloviove in Donetsk Oblast and Kotliarivka in Kharkiv Oblast, 20 kilometers from Kupiansk. Ukraine claimed to have destroyed a Russian military fast attack craft in Crimea using a naval drone. Ukrainian forces claimed a series of successful counterattacks against Russian forces near Bakhmut, resulting in an advance of some 500 metres, and inflicting casualties on Russian soldiers and the destruction of four supply trucks, a BMP-2, and a BMD-4 using drones. Russia released footage of a Ka-29 opening fire on a Sea Baby drone armed with a R-73 infrared missile to defend it from helicopters. One missile appeared to have been fired before it was destroyed by gunfire. In response to perceived threats from France, Britain, and the United States, Russia announced it would practice the deployment of tactical nuclear weapons as part of a military exercise.
== Laboratory equipments and machines == Microscope – Scientific instrument for observing small objects Incubator – Device used to grow and maintain microbiological cultures or cell cultures Centrifuge – Device using centrifugal force to separate fluids Electrophoresis – Motion of charged particles in electric field Haematology – To count and identify blood cells at high speed and accuracy Spectrophotometer – Instrument to measure light intensity Glucometer – Medical device for determining the concentration of glucose in the blood Pipette – Liquid-transferring laboratory tool Beaker – Glass container used in laboratories Erlenmeyer flask – Laboratory flask with a flat bottom Petridish – Shallow dish used to hold cell cultures Hemocytometer – Medical device used to count cells Test tube – Glass or plastic laboratory glassware & Racks Hot air oven – Electrical device which uses dry heat to sterilize substances Refrigerator – Appliance for cold food storage Biochemistry analyzer – Medical laboratory instrumentPages displaying short descriptions of redirect targets Burette – Graduated glass tube with a tap at one end Water distillation – Water purified by condensing it from steamPages displaying short descriptions of redirect targets Analytical balance – Type of digital balance pH meter – Instrument measuring acidity or alkalinity of solutions
== Alternative Medical Causes of Altered Turgor == Altered skin turgor can be caused by chronic medical conditions completely unrelated to an individual's immediate hydration status. Systemic sclerosis, or scleroderma, is an autoimmune disorder that triggers excessive collage production, resulting in abnormally tight, hard, and shiny skin that exhibits high turgor and cannot be pinched at all. On the other hand, genetic connective tissue disorders can drastically lower baseline skin tension, making the skin hyper-elastic. Additionally, localized fluid retention or severe edema stretches the dermis tightly, masking underlying systemic dehydration by artificially inflating skin turgor measurements.
Paregoric, or camphorated tincture of opium, also known as tinctura opii camphorata, is a patent medicine known for its antidiarrheal, antitussive, and analgesic properties. According to Goodman and Gilman's 1965 edition, "Paregoric is a 4% opium tincture in which there is also benzoic acid, camphor, and anise oil. ... Paregoric by tradition is used especially for children." The term paregoric, which comes from Ancient Greek παρηγορικός parēgorikós "soothing", has also been used for boiled sweets which contained the substance, in particular the Army & Navy brand.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Sources: en.wikipedia.org
=== Flower press === This floral preservation has its roots in Victorian times, but has also been brought into the current list of Floral Preservation because of new techniques of pressing, vacuum sealing and color enhancing. This method uses a "flower press" that sandwiches the flower between two rigid layers, often lined with a breathable/adsorbent fabric to allow moisture to leave the flower, then applies a small amount of pressure to the flower, allowing it to keep its shape while it dries. The art is then framed in a flat shadow box style frame, to hang on the wall. Vacuum sealing the art is recommended and the use of Museum Quality glass with a UV Factor of 97% to ensure the colors last.
== Further reading == Castka, Joseph F.; Metcalfe, H. Clark; Davis, Raymond E.; Williams, John E. (2002). Modern Chemistry. Holt, Rinehart and Winston. ISBN 978-0-03-056537-3. Guch, Ian (2003). The Complete Idiot's Guide to Chemistry. Alpha, Penguin Group Inc. ISBN 978-1-59257-101-7. Mascetta, Joseph A. (1998). How to Prepare for the SAT II Chemistry. Barron's. ISBN 978-0-7641-0331-5.
== Season 10 (2024) == This season is themed around mad scientists, with host John Henson as the owner of "Henson Laboratories". In each challenge, bakers are asked to create desserts to appease the evil spirits that haunt the lab.
== Geography == According to the United States Census Bureau, the city has an area of 2.70 square miles (6.99 km2); 2.67 square miles (6.92 km2) is land and 0.03 square miles (0.08 km2) is water. The Sauk River bisects Cold Spring from the southwest. Cold Spring is in Wakefield Township geographically but is a separate entity.
== Structure == FSH is a 35.5 kDa glycoprotein heterodimer, consisting of two polypeptide units, alpha and beta. Its structure is similar to those of luteinizing hormone (LH), thyroid-stimulating hormone (TSH), and human chorionic gonadotropin (hCG). The alpha subunits of the glycoproteins LH, FSH, TSH, and hCG are identical and consist of 96 amino acids, while the beta subunits vary. Both subunits are required for biological activity. FSH has a beta subunit of 111 amino acids (FSH β), which confers its specific biologic action, and is responsible for interaction with the follicle-stimulating hormone receptor. The sugar portion of the hormone is covalently bonded to asparagine, and is composed of N-acetylgalactosamine, mannose, N-acetylglucosamine, galactose, and sialic acid.
Sources: en.wikipedia.org
GSH is the reduced form of glutathione, with a free thiol group on cysteine. GSSG is the oxidized disulfide form, created when two GSH molecules become linked. The two forms exist together, and their balance is often reported as the GSH/GSSG ratio in laboratory studies.
Glutathione is synthesized inside cells from amino acids rather than being classified as an essential dietary nutrient. Dietary sources can provide glutathione or its precursors, but digestion and absorption alter what reaches tissues. Research continues on how dietary intake relates to cellular glutathione levels.
The liver has high glutathione concentrations and uses the compound in conjugation and antioxidant reactions. These reactions are relevant to the processing of drugs, pollutants, and normal metabolic byproducts. Studies often examine liver glutathione as a marker of oxidative stress or detoxification capacity.
It is a tripeptide rather than a full protein. Proteins generally contain many amino acids joined by alpha-peptide bonds, while glutathione has three residues and an unusual gamma-glutamyl linkage. That structure affects how enzymes recognize and break it down.